Panasonic DMR-E20K Operating Instructions Manual

Also see for DMR-E20K: Operating instructions

Contents

Panasonic DMR-E20K Operating Instructions Manual Manual pdf 38 page image

38RQT6035Advanced operations1234TVCHTV/AVPROG / CHECKTOP WINDOWFRAMESKIPSTOPVCR Plus +RECTIME SLIP CM SKIPV.S.S.ACTIONAUDIOADD/DLTREC MODE CANCELINPUTSELECTLASTMARKERMARKERWRITEDVDPAUSE PLAYSLOW/SEARCHSTATUSRETURNENTERVOLPOWERPOWER OPEN/CLOSETCERIDROTAGIVANTOPMENUMENUDISPLAYTSILYALPCH1 2 34 5 67 8 90 100TOP WINDOWPLAYENTERENTER1 2 34 5 67 8 90TVDVD314∫, STOPDVD, TVCANCELRETURN26, 5,SLOW/SEARCHConvenient featuresProgram play[CD] [VCD]You can select up to 100 tracks to play in the order you choose.PreparationSwitch [DVD, TV] to “DVD”.1 While stoppedPress [TOP WINDOW].2 Use the joystick [3, 4, 2, 1] toselect “PROGRAM PLAY” and press[ENTER].3 Press the numbered buttons to selectthe track.Example: “5”: [0] ➡ [5]Example: “15”: [1] ➡ [5]Repeat step 3 to select other tracks.³You can also use the joystick to select tracks.1 Press [ENTER], then use the joystick [3, 4] to selectthe track.2 Press [ENTER].4 Press [1, PLAY].Play starts in the programmed sequence.º To move to the page before or after the oneshownPress [6, SLOW/SEARCH] or [5, SLOW/SEARCH].º To clear the programmed tracks one by one1. Use the joystick [3, 4] to select the track you want to clear.2. Press [CANCEL].Alternatively, use the joystick [3, 4, 2, 1] to select “Clear” andpress [ENTER].º To clear the whole programUse the joystick [3, 4, 2, 1] to select “All Clear” and press[ENTER].³The whole program is also cleared when you turn the unit off oropen the disc tray.º To exit the program mode1. Press [º, STOP] during play until the program play screen isdisplayed.2. Press [TOP WINDOW] or [RETURN].Total time of the programTrack numberProgram numberTOPPROGRAM PLAY6 ∫ 1 5No. TimeTrackTotal Time1 5202:0202:0233PROGRAM PLAY Choose a track, then press ENTER.0 Press PLAY to start.PlayClearAll ClearRETURNENTERSELECT6 ∫ 1 5